PDB entry 1tig

View 1tig on RCSB PDB site
Description: translation initiation factor 3 c-terminal domain
Class: ribosome binding factor
Keywords: if3 c-terminal domain, ribosome binding factor
Deposited on 1995-08-16, released 1995-12-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: translation initiation factor 3
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: T7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1tiga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tigA (A:)
    kqkvinvkevrlsptieehdfntklrnarkflekgdkvkatirfkgraithkeigqrvld
    rlseacadiavvetapkmdgrnmflvlapkndnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tigA (A:)
    invkevrlsptieehdfntklrnarkflekgdkvkatirfkgraithkeigqrvldrlse
    acadiavvetapkmdgrnmflvlapknd