PDB entry 1thc

View 1thc on RCSB PDB site
Description: crystal structure determination at 2.3a of human transthyretin-3',5'- dibromo-2',4,4',6-tetra-hydroxyaurone complex
Deposited on 1992-04-20, released 1993-07-15
The last revision prior to the SCOP 1.61 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.179
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1thca_
  • Chain 'B':
    Domains in SCOP 1.61: d1thcb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1thcA (A:)
kcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegi
ykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1thcB (B:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn