PDB entry 1tfk

View 1tfk on RCSB PDB site
Description: Ribonuclease from Escherichia coli complexed with its inhibtor protein
Class: toxin/toxin inhibitor
Keywords: protein-protein complex, toxin/toxin inhibitor complex
Deposited on 2004-05-27, released 2005-03-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.225
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Colicin D
    Species: Escherichia coli [TaxId:562]
    Gene: CDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tfka_
  • Chain 'B':
    Compound: Colicin D immunity protein
    Species: Escherichia coli [TaxId:562]
    Gene: CDI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11899 (Start-85)
      • expression tag (86)
    Domains in SCOPe 2.06: d1tfkb2, d1tfkb3
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tfkA (A:)
qldkkykhagdfgisdtkknretltkfrdaieehlsdkdtvekgtyrrekgskvyfnpnt
mnvviiksngeflsgwkinpdadngriyletgel

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1tfkB (B:)
nkmamidlaklflaskitaiefsericverrrlygvkdlspnilncgeelfmaaerfepd
adranyeiddnglkvevrsilekfklhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1tfkB (B:)
kmamidlaklflaskitaiefsericverrrlygvkdlspnilncgeelfmaaerfepda
dranyeiddnglkvevrsilekfklh