PDB entry 1tf3

View 1tf3 on RCSB PDB site
Description: tfiiia finger 1-3 bound to DNA, nmr, 22 structures
Class: transcription/DNA
Keywords: nmr, tfiiia, protein, DNA, transcription factor, 5s RNA gene, DNA binding protein, zinc finger, complex (transcription regulation/DNA), transcription/DNA complex
Deposited on 1997-07-01, released 1997-09-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcription factor iiia
  Species: Xenopus laevis [TaxId:8355]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03001 (0-91)
    • engineered (0)
    • engineered (25)
  Domains in SCOPe 2.04: d1tf3a1, d1tf3a2, d1tf3a3
• Chain 'E':
  Compound: 5s RNA gene
  Species: synthetic, synthetic
  
• Chain 'F':
  Compound: 5s RNA gene
  Species: synthetic, synthetic
  
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tf3A (A:)
  mkryicsfadcgaaynknwklqahlskhtgekpfpckeegcekgftslhhltrhslthtg
  eknftcdsdgcdlrfttkanmkkhfnrfhnik
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.