PDB entry 1tf3

View 1tf3 on RCSB PDB site
Description: tfiiia finger 1-3 bound to dna, nmr, 22 structures
Deposited on 1997-07-01, released 1997-09-17
The last revision prior to the SCOP 1.61 freeze date was dated 1997-09-17, with a file datestamp of 1997-09-17.
Experiment type: NMR22
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1tf3a1, d1tf3a2, d1tf3a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tf3A (A:)
  mkryicsfadcgaaynknwklqahlskhtgekpfpckeegcekgftslhhltrhslthtg
  eknftcdsdgcdlrfttkanmkkhfnrfhnik