PDB entry 1tey

View 1tey on RCSB PDB site
Description: NMR structure of human histone chaperone, ASF1A
Class: chaperone
Keywords: beta-sandwich, distorted immunoglobulin-like, chaperone
Deposited on 2004-05-26, released 2005-04-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ASF1 anti-silencing function 1 homolog A
    Species: Homo sapiens [TaxId:9606]
    Gene: ASF1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1teya1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1teyA (A:)
    gamakvqvnnvvvldnpspfynpfqfeitfeciedlsedlewkiiyvgsaeseeydqvld
    svlvgpvpagrhmfvfqadapnpglipdadavgvtvvlitctyrgqefirvgyyvnneyt
    etelrenppvkpdfsklqrnilasnprvtrfhinwedn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1teyA (A:)
    makvqvnnvvvldnpspfynpfqfeitfeciedlsedlewkiiyvgsaeseeydqvldsv
    lvgpvpagrhmfvfqadapnpglipdadavgvtvvlitctyrgqefirvgyyvnneytet
    elrenppvkpdfsklqrnilasnprvtrfhinwedn