PDB entry 1te4

View 1te4 on RCSB PDB site
Description: Solution structure of MTH187. Ontario Centre for Structural Proteomics target MTH0187_1_111; Northeast Structural Genomics Target TT740
Class: structural genomics, unknown function
Keywords: NMR, MTH187, Methanobacterium thermoautotrophicum, structural proteomics, HEAT-like repeat, structural genomics, OCSP, NESG, PROTEIN STRUCTURE INITIATIVE, PSI, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2004-05-24, released 2004-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved protein MTH187
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: mt0187
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1te4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1te4A (A:)
    mgsshhhhhhssglvprgshmadenkwvrrdvstalsrmgdeafeplleslsnedwrirg
    aaawiignfqderavepliklleddsgfvrsgaarsleqiggervraameklaetgtgfa
    rkvavnyleth
    

    Sequence, based on observed residues (ATOM records): (download)
    >1te4A (A:)
    madenkwvrrdvstalsrmgdeafeplleslsnedwrirgaaawiignfqderaveplik
    lleddsgfvrsgaarsleqiggervraameklaetgtgfarkvavnyleth