PDB entry 1tcs

View 1tcs on RCSB PDB site
Description: crystal structure of trichosanthin-nadph complex at 1.7 angstroms resolution reveals active-site architecture
Class: protein synthesis inhibitor
Keywords: toxin, protein synthesis inhibitor
Deposited on 1994-12-27, released 1995-07-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.174
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trichosanthin
    Species: Trichosanthes kirilowii [TaxId:3677]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1tcsa_
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tcsA (A:)
dvsfrlsgatsssygvfisnlrkalpnerklydipllrsslpgsqryalihltnyadeti
svaidvtnvyimgyragdtsyffneasateaakyvfkdamrkvtlpysgnyerlqtaagk
ireniplglpaldsaittlfyynansaasalmvliqstseaarykfieqqigkrvdktfl
pslaiislenswsalskqiqiastnngqfespvvlinaqnqrvtitnvdagvvtsniall
lnrnnma