PDB entry 1tbu

View 1tbu on RCSB PDB site
Description: Crystal structure of N-terminal domain of yeast peroxisomal thioesterase-1
Class: hydrolase
Keywords: Yeast peroxisomal thioesterase; X-ray structure; domain swapping; iodine soak; SIRAS, HYDROLASE
Deposited on 2004-05-20, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.216
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisomal acyl-coenzyme A thioester hydrolase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PTE1, TES1, YJR019C, J1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tbua1
  • Chain 'B':
    Compound: Peroxisomal acyl-coenzyme A thioester hydrolase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PTE1, TES1, YJR019C, J1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tbub_
  • Chain 'C':
    Compound: Peroxisomal acyl-coenzyme A thioester hydrolase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PTE1, TES1, YJR019C, J1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tbuc_
  • Chain 'D':
    Compound: Peroxisomal acyl-coenzyme A thioester hydrolase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PTE1, TES1, YJR019C, J1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tbud_
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tbuA (A:)
    msaskmamsnlekilelvplsptsfvtkylpaapvgskgtfggtlvsqsllaslhtvpln
    ffptslhsyfikggdprtkityhvqnlrngrnfihkqvsayqhdkliftsmilfavqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tbuA (A:)
    kilelvplsptsfvtkylptfggtlvsqsllaslhtvplnffptslhsyfikggdprtki
    tyhvqnlrngrnfihkqvsayqhdkliftsmilfav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tbuB (B:)
    msaskmamsnlekilelvplsptsfvtkylpaapvgskgtfggtlvsqsllaslhtvpln
    ffptslhsyfikggdprtkityhvqnlrngrnfihkqvsayqhdkliftsmilfavqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tbuB (B:)
    kilelvplsptsfvtkylgtfggtlvsqsllaslhtvplnffptslhsyfikggdprtki
    tyhvqnlrngrnfihkqvsayqhdkliftsmilfavqr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tbuC (C:)
    msaskmamsnlekilelvplsptsfvtkylpaapvgskgtfggtlvsqsllaslhtvpln
    ffptslhsyfikggdprtkityhvqnlrngrnfihkqvsayqhdkliftsmilfavqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tbuC (C:)
    ilelvplsptsfvtkylptfggtlvsqsllaslhtvplnffptslhsyfikggdprtkit
    yhvqnlrngrnfihkqvsayqhdkliftsmilfavq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tbuD (D:)
    msaskmamsnlekilelvplsptsfvtkylpaapvgskgtfggtlvsqsllaslhtvpln
    ffptslhsyfikggdprtkityhvqnlrngrnfihkqvsayqhdkliftsmilfavqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tbuD (D:)
    ilelvplsptsfvtkylgtfggtlvsqsllaslhtvplnffptslhsyfikggdprtkit
    yhvqnlrngrnfihkqvsayqhdkliftsmilfavqr