Lineage for d1tbub_ (1tbu B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943764Family d.38.1.3: Acyl-CoA thioesterase [54644] (2 proteins)
    duplication: consists of two domains of this fold
  6. 2943765Protein Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 [143166] (1 species)
  7. 2943766Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143167] (1 PDB entry)
    Uniprot P41903 13-116
  8. 2943768Domain d1tbub_: 1tbu B: [119224]
    automated match to d1tbua1
    complexed with fmt

Details for d1tbub_

PDB Entry: 1tbu (more details), 2.2 Å

PDB Description: Crystal structure of N-terminal domain of yeast peroxisomal thioesterase-1
PDB Compounds: (B:) Peroxisomal acyl-coenzyme A thioester hydrolase 1

SCOPe Domain Sequences for d1tbub_:

Sequence, based on SEQRES records: (download)

>d1tbub_ d.38.1.3 (B:) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kilelvplsptsfvtkylpaapvgskgtfggtlvsqsllaslhtvplnffptslhsyfik
ggdprtkityhvqnlrngrnfihkqvsayqhdkliftsmilfavqr

Sequence, based on observed residues (ATOM records): (download)

>d1tbub_ d.38.1.3 (B:) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kilelvplsptsfvtkylgtfggtlvsqsllaslhtvplnffptslhsyfikggdprtki
tyhvqnlrngrnfihkqvsayqhdkliftsmilfavqr

SCOPe Domain Coordinates for d1tbub_:

Click to download the PDB-style file with coordinates for d1tbub_.
(The format of our PDB-style files is described here.)

Timeline for d1tbub_: