| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
| Family d.38.1.3: Acyl-CoA thioesterase [54644] (2 proteins) duplication: consists of two domains of this fold |
| Protein Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 [143166] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143167] (1 PDB entry) Uniprot P41903 13-116 |
| Domain d1tbub_: 1tbu B: [119224] automated match to d1tbua1 complexed with fmt |
PDB Entry: 1tbu (more details), 2.2 Å
SCOPe Domain Sequences for d1tbub_:
Sequence, based on SEQRES records: (download)
>d1tbub_ d.38.1.3 (B:) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kilelvplsptsfvtkylpaapvgskgtfggtlvsqsllaslhtvplnffptslhsyfik
ggdprtkityhvqnlrngrnfihkqvsayqhdkliftsmilfavqr
>d1tbub_ d.38.1.3 (B:) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kilelvplsptsfvtkylgtfggtlvsqsllaslhtvplnffptslhsyfikggdprtki
tyhvqnlrngrnfihkqvsayqhdkliftsmilfavqr
Timeline for d1tbub_: