PDB entry 1t7t

View 1t7t on RCSB PDB site
Description: Crystal structure of the androgen receptor ligand binding domain in complex with 5-alpha dihydrotestosterone
Class: hormone/growth factor receptor
Keywords: nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich, HORMONE/GROWTH FACTOR RECEPTOR COMPLEX
Deposited on 2004-05-10, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.181
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: Pan troglodytes [TaxId:9598]
    Gene: Ar, Nr3c4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t7ta_
  • Heterogens: DHT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t7tA (A:)
    gspgisgggggshiegyecqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelger
    qlvhvvkwakalpgfrnlhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvf
    neyrmhksrmysqcvrmrhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdel
    rmnyikeldriiackrknptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvd
    fpemmaeiisvqvpkilsgkvkpiyfhtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t7tA (A:)
    cqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnl
    hvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmr
    hlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrkn
    ptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkils
    gkvkpiyfht