Lineage for d1t7ta_ (1t7t A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728287Protein Androgen receptor [63621] (4 species)
  7. 2728288Species Chimpanzee (Pan troglodytes) [TaxId:9598] [109986] (8 PDB entries)
    Uniprot O97775 661-910 # 100% sequence identity to human sequence (Uniprot P10275 669-918)
  8. 2728292Domain d1t7ta_: 1t7t A: [106638]
    complexed with dht

Details for d1t7ta_

PDB Entry: 1t7t (more details), 1.7 Å

PDB Description: Crystal structure of the androgen receptor ligand binding domain in complex with 5-alpha dihydrotestosterone
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d1t7ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t7ta_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]}
cqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnl
hvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmr
hlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrkn
ptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkils
gkvkpiyfht

SCOPe Domain Coordinates for d1t7ta_:

Click to download the PDB-style file with coordinates for d1t7ta_.
(The format of our PDB-style files is described here.)

Timeline for d1t7ta_: