PDB entry 1t31

View 1t31 on RCSB PDB site
Description: A Dual Inhibitor of the Leukocyte Proteases Cathepsin G and Chymase with Therapeutic Efficacy in Animals Models of Inflammation
Class: hydrolase
Keywords: HUMAN CHYMASE, SERINE PROTEINASE, hydrolase
Deposited on 2004-04-23, released 2005-03-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chymase
    Species: Homo sapiens [TaxId:9606]
    Gene: CMA1, CYM, CYH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23946 (0-225)
      • engineered (115)
      • engineered (190)
      • engineered (215)
    Domains in SCOPe 2.08: d1t31a_
  • Heterogens: NAG, SO4, CO, OHH, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t31A (A:)
    iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
    teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqknfvppg
    rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
    dsggpllcagaaqgivsygrsdakppavftrishyqpwinqilqan