Lineage for d1t31a_ (1t31 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795068Protein Chymase (mast cell protease I) [89343] (1 species)
  7. 2795069Species Human (Homo sapiens) [TaxId:9606] [89344] (13 PDB entries)
  8. 2795079Domain d1t31a_: 1t31 A: [119135]
    automated match to d1pjpa_
    complexed with co, mes, nag, ohh, so4

Details for d1t31a_

PDB Entry: 1t31 (more details), 1.9 Å

PDB Description: a dual inhibitor of the leukocyte proteases cathepsin g and chymase with therapeutic efficacy in animals models of inflammation
PDB Compounds: (A:) Chymase

SCOPe Domain Sequences for d1t31a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t31a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqknfvppg
rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
dsggpllcagaaqgivsygrsdakppavftrishyqpwinqilqan

SCOPe Domain Coordinates for d1t31a_:

Click to download the PDB-style file with coordinates for d1t31a_.
(The format of our PDB-style files is described here.)

Timeline for d1t31a_: