Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Chymase (mast cell protease I) [89343] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89344] (13 PDB entries) |
Domain d1t31a_: 1t31 A: [119135] automated match to d1pjpa_ complexed with co, mes, nag, ohh, so4 |
PDB Entry: 1t31 (more details), 1.9 Å
SCOPe Domain Sequences for d1t31a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t31a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqknfvppg rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg dsggpllcagaaqgivsygrsdakppavftrishyqpwinqilqan
Timeline for d1t31a_: