PDB entry 1t2l

View 1t2l on RCSB PDB site
Description: Three Crystal Structures of Human Coactosin-like Protein
Class: protein binding
Keywords: beta-sheet, PROTEIN BINDING
Deposited on 2004-04-22, released 2004-11-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.197
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coactosin-like protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14019 (0-End)
      • modified residue (68)
    Domains in SCOPe 2.08: d1t2la_
  • Chain 'B':
    Compound: Coactosin-like protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14019 (0-End)
      • modified residue (68)
    Domains in SCOPe 2.08: d1t2lb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t2lA (A:)
    atkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlfaf
    vrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrkele
    edfikselkkagganydaqte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t2lA (A:)
    atkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlfaf
    vrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrkele
    edfikselkkaggany
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t2lB (B:)
    atkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlfaf
    vrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrkele
    edfikselkkagganydaqte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t2lB (B:)
    atkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlfaf
    vrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrkele
    edfikselkk