Lineage for d1t2la_ (1t2l A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534201Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2534202Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2534346Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 2534351Protein Coactosin-like protein Cotl1 (Clp) [111105] (2 species)
  7. 2534352Species Human (Homo sapiens) [TaxId:9606] [111107] (2 PDB entries)
    Uniprot Q14019
  8. 2534353Domain d1t2la_: 1t2l A: [112224]

Details for d1t2la_

PDB Entry: 1t2l (more details), 2.8 Å

PDB Description: Three Crystal Structures of Human Coactosin-like Protein
PDB Compounds: (A:) Coactosin-like protein

SCOPe Domain Sequences for d1t2la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2la_ d.109.1.2 (A:) Coactosin-like protein Cotl1 (Clp) {Human (Homo sapiens) [TaxId: 9606]}
atkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlfaf
vrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrkele
edfikselkkaggany

SCOPe Domain Coordinates for d1t2la_:

Click to download the PDB-style file with coordinates for d1t2la_.
(The format of our PDB-style files is described here.)

Timeline for d1t2la_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t2lb_