PDB entry 1t1v

View 1t1v on RCSB PDB site
Description: Crystal Structure of the Glutaredoxin-like Protein SH3BGRL3 at 1.6 A resolution
Deposited on 2004-04-19, released 2004-06-29
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-29, with a file datestamp of 2004-06-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.202
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1t1va_
  • Chain 'B':
    Domains in SCOP 1.69: d1t1vb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1t1vA (A:)
msglrvystsvtgsreiksqqsevtrildgkriqyqlvdisqdnalrdemrtlagnpkat
ppqivngnhycgdyelfveaveqdtlqeflkla

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1t1vB (B:)
msglrvystsvtgsreiksqqsevtrildgkriqyqlvdisqdnalrdemrtlagnpkat
ppqivngnhycgdyelfveaveqdtlqeflkla