SCOP 1.69: Domain d1t1va_: 1t1v A:

Lineage for d1t1va_ (1t1v A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (15 families)

5. Family c.47.1.14: SH3BGR (SH3-binding, glutamic acid-rich protein-like) [102446] (1 protein)
   related to glutaredoxin 1 (GRX1) but lacks both conserved cysteine residues

6. Protein SH3BGRL3 [102447] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [102448] (2 PDB entries)

8. Domain d1t1va_: 1t1v A: [106278]

Details for d1t1va_

PDB Entry: 1t1v, 1.6 Å

PDB Description: Crystal Structure of the Glutaredoxin-like Protein SH3BGRL3 at 1.6 A resolution

SCOP Domain Sequences for d1t1va_:

Sequence; same for both SEQRES and ATOM records:

>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus)}
msglrvystsvtgsreiksqqsevtrildgkriqyqlvdisqdnalrdemrtlagnpkat
ppqivngnhycgdyelfveaveqdtlqeflkla

Timeline for d1t1va_:

• d1t1va_ is new in SCOP 1.69
  
• d1t1va_ appears in SCOP 1.71
  
• d1t1va_ appears in the current release, SCOPe 2.08