PDB entry 1t0y

View 1t0y on RCSB PDB site
Description: Solution Structure of a Ubiquitin-Like Domain from Tubulin-binding Cofactor B
Class: chaperone
Keywords: ubiquitin-like, cytoskeleton, microtubule, tubulin, CESG, Structural genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CHAPERONE
Deposited on 2004-04-13, released 2004-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tubulin folding cofactor B
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: 5O73 or F53F4.3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t0ya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1t0yA (A:)
gsmtevydleittnatdfpmekkypagmslndlkkklelvvgttvdsmriqlfdgddqlk
geltdgakslkdlgvrdgyrihavdvtggnedfkdesmvekyemsddtygkrtdsvrawk
kk

    Sequence, based on observed residues (ATOM records): (download) 
    >1t0yA (A:)
mtevydleittnatdfpmekkypagmslndlkkklelvvgttvdsmriqlfdgddqlkge
ltdgakslkdlgvrdgyrihavdvtggned