Lineage for d1t0ya_ (1t0y A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932376Protein Ubiquitin-like domain of tubulin folding cofactor B [102786] (2 species)
  7. 2932379Species Nematode (Caenorhabditis elegans) [TaxId:6239] [102787] (1 PDB entry)
  8. 2932380Domain d1t0ya_: 1t0y A: [99066]

Details for d1t0ya_

PDB Entry: 1t0y (more details)

PDB Description: solution structure of a ubiquitin-like domain from tubulin-binding cofactor b
PDB Compounds: (A:) tubulin folding cofactor B

SCOPe Domain Sequences for d1t0ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mtevydleittnatdfpmekkypagmslndlkkklelvvgttvdsmriqlfdgddqlkge
ltdgakslkdlgvrdgyrihavdvtggned

SCOPe Domain Coordinates for d1t0ya_:

Click to download the PDB-style file with coordinates for d1t0ya_.
(The format of our PDB-style files is described here.)

Timeline for d1t0ya_: