PDB entry 1t07

View 1t07 on RCSB PDB site
Description: Crystal Structure of Conserved Protein of Unknown Function PA5148 from Pseudomonas aeruginosa
Class: Structural genomics, unknown function
Keywords: Structural genomics, APC5047, PA5148, Conserved hypothetical protein, Pseudomonas aeruginosa, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2004-04-07, released 2004-08-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0269 protein PA5148
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA5148
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HU36 (2-End)
      • cloning artifact (0-1)
      • modified residue (2)
      • modified residue (7)
      • modified residue (49)
      • modified residue (58-59)
      • modified residue (71)
    Domains in SCOPe 2.04: d1t07a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t07A (A:)
    ghmsrtvmcrkyheelpgldrppypgakgediynnvsrkawdewqkhqtmlinerrlnmm
    naedrkflqqemdkflsgedyakadgyvppsags
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t07A (A:)
    ghmsrtvmcrkyheelpgldrppypgakgediynnvsrkawdewqkhqtmlinerrlnmm
    naedrkflqqemdkflsgedy