PDB entry 1syl

View 1syl on RCSB PDB site
Description: Crystal structure of inactive mutant dUTPase complexed with substrate dUTP
Class: hydrolase
Keywords: enzyme-ligand complex, jelly roll, HYDROLASE
Deposited on 2004-04-01, released 2004-09-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.16
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Escherichia coli [TaxId:562]
    Gene: dut
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06968 (1-End)
      • initiating methionine (0)
      • engineered (89)
    Domains in SCOPe 2.04: d1syla_
  • Heterogens: MG, DUT, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sylA (A:)
    mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
    dpslaammlprsglghkhgivlgnlvglinsdyqgqlmisvwnrgqdsftiqpgeriaqm
    ifvpvvqaefnlvedfdatdrgeggfghsgrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sylA (A:)
    mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
    dpslaammlprsglghkhgivlgnlvglinsdyqgqlmisvwnrgqdsftiqpgeriaqm
    ifvpvvqaefnlvedfd