PDB entry 1svq

View 1svq on RCSB PDB site
Description: structure of severin domain 2 in solution
Class: actin-binding
Keywords: actin-binding
Deposited on 1994-10-12, released 1995-02-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: severin
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1svqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1svqA (A:)
sgfnhvkpteykprllhisgdknakvaevplatsslnsgdcflldagltiyqfngskssp
qeknkaaevaraidaerkglpkvevfcetdsdipaefwkllggkgaiaakheta

    Sequence, based on observed residues (ATOM records): (download) 
    >1svqA (A:)
eykprllhisgdknakvaevplatsslnsgdcflldagltiyqfngsksspqeknkaaev
araidaerkglpkvevfcetdsdipaefwkllgg