PDB entry 1sso

View 1sso on RCSB PDB site
Description: solution structure and DNA-binding properties of a thermostable protein from the archaeon sulfolobus solfataricus
Class: DNA-binding protein
Keywords: DNA-binding protein
Deposited on 1995-03-31, released 1995-05-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sso7d
  Species: Sulfolobus solfataricus [TaxId:2287]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61991 (0-61)
  Domains in SCOPe 2.04: d1ssoa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ssoA (A:)
  atvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
  qk