PDB entry 1ssl

View 1ssl on RCSB PDB site
Description: Solution structure of the PSI domain from the Met receptor
Class: structural protein
Keywords: cysteine knot, STRUCTURAL PROTEIN
Deposited on 2004-03-24, released 2004-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (4-47)
      • cloning artifact (0-3)
    Domains in SCOPe 2.08: d1ssla1, d1ssla2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sslA (A:)
    gsamgcrhfqscsqclsappfvqcgwchdkcvrseeclsgtwtqqicl