Lineage for d1ssla1 (1ssl A:5-48)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033514Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
    disulfide-rich fold; common core is alpha+beta with two conserved disulfides
  4. 3033549Superfamily g.16.2: Plexin repeat [103575] (1 family) (S)
  5. 3033550Family g.16.2.1: Plexin repeat [103576] (3 proteins)
    Pfam PF01437
  6. 3033551Protein Hepatocyte growth factor receptor [111407] (1 species)
  7. 3033552Species Human (Homo sapiens) [TaxId:9606] [111408] (3 PDB entries)
    Uniprot P08581 40-564
  8. 3033555Domain d1ssla1: 1ssl A:5-48 [112113]
    Other proteins in same PDB: d1ssla2

Details for d1ssla1

PDB Entry: 1ssl (more details)

PDB Description: solution structure of the psi domain from the met receptor
PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d1ssla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ssla1 g.16.2.1 (A:5-48) Hepatocyte growth factor receptor {Human (Homo sapiens) [TaxId: 9606]}
gcrhfqscsqclsappfvqcgwchdkcvrseeclsgtwtqqicl

SCOPe Domain Coordinates for d1ssla1:

Click to download the PDB-style file with coordinates for d1ssla1.
(The format of our PDB-style files is described here.)

Timeline for d1ssla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ssla2