SCOPe 2.07: Structural Classification of Proteins

PDB entry 1smy

View 1smy on RCSB PDB site
Description: Structural basis for transcription regulation by alarmone ppGpp
Class: transferase
Keywords: RNA POLYMERASE HOLOENZYME, Guanosine-tetraphosphate, ppGpp, transcription regulation, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, TRANSFERASE
Deposited on 2004-03-10, released 2004-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.186
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: DNA-directed RNA polymerase alpha chain
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9Z9H6 (0-End)
Domains in SCOPe 2.07: d1smya1, d1smya2
Chain 'B':
Compound: DNA-directed RNA polymerase alpha chain
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9Z9H6 (0-End)
Domains in SCOPe 2.07: d1smyb1, d1smyb2
Chain 'C':
Compound: DNA-directed RNA polymerase beta chain
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8RQE9 (0-1118)
Domains in SCOPe 2.07: d1smyc_
Chain 'D':
Compound: DNA-directed RNA polymerase beta' chain
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8RQE8
Domains in SCOPe 2.07: d1smyd_
Chain 'E':
Compound: RNA polymerase omega subunit
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- PDB 1SMY
Domains in SCOPe 2.07: d1smye_
Chain 'F':
Compound: principal sigma factor
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- GB BAA74758 (Start-422)
Domains in SCOPe 2.07: d1smyf1, d1smyf2, d1smyf3
Chain 'K':
Compound: DNA-directed RNA polymerase alpha chain
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9Z9H6 (0-End)
Domains in SCOPe 2.07: d1smyk1, d1smyk2
Chain 'L':
Compound: DNA-directed RNA polymerase alpha chain
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9Z9H6 (0-End)
Domains in SCOPe 2.07: d1smyl1, d1smyl2
Chain 'M':
Compound: DNA-directed RNA polymerase beta chain
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8RQE9 (0-1118)
Domains in SCOPe 2.07: d1smym_
Chain 'N':
Compound: DNA-directed RNA polymerase beta' chain
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8RQE8
Domains in SCOPe 2.07: d1smyn_
Chain 'O':
Compound: RNA polymerase omega subunit
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- PDB 1SMY
Domains in SCOPe 2.07: d1smyo_
Chain 'P':
Compound: principal sigma factor
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- GB BAA74758 (Start-422)
Domains in SCOPe 2.07: d1smyp1, d1smyp2, d1smyp3
Heterogens: MG, ZN, G4P, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1smyA (A:)
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapeeak
epeappeqeeeldlpleelglstrvlhslkeegiesvrallalnlkdlknipgigersle
eikealekkgftlke