PDB entry 1sm3

View 1sm3 on RCSB PDB site
Description: crystal structure of the tumor specific antibody sm3 complex with its peptide epitope
Class: complex (antibody/peptide epitope)
Keywords: antibody, peptide antigen, antitumor antibody, complex (antibody/peptide epitope)
Deposited on 1997-12-23, released 1999-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.213
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: sm3 antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01801 (1-End)
      • conflict (2)
      • conflict (4)
      • conflict (19)
      • conflict (27)
      • conflict (30)
      • conflict (42)
      • conflict (47)
      • conflict (51)
      • insertion (58)
      • conflict (99-100)
      • conflict (102)
      • conflict (111)
      • conflict (116)
      • conflict (123)
      • conflict (163)
      • conflict (211)
    Domains in SCOPe 2.07: d1sm3h1, d1sm3h2, d1sm3h3
  • Chain 'L':
    Compound: sm3 antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01723 (2-End)
      • conflict (110-111)
    Domains in SCOPe 2.07: d1sm3l1, d1sm3l2
  • Chain 'P':
    Compound: peptide epitope
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CD, CL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1sm3H (H:)
    qvqlqesggglvqpggsmklscvasgftfsnywmnwvrqspekglewvaeirlksnnyat
    hyaesvkgrftisrddskssvylqmnnlraedtgiyyctgvgqfaywgqgttvtvssakt
    tpptvyplapgsnaasqsmvtlgclvkgyfpepvtvtwnsgslasgvhtfpavlqsdlyt
    lsssvtvpsstwpsetvtcnvahpasstkvdakivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sm3H (H:)
    qvqlqesggglvqpggsmklscvasgftfsnywmnwvrqspekglewvaeirlksnnyat
    hyaesvkgrftisrddskssvylqmnnlraedtgiyyctgvgqfaywgqgttvtvssakt
    tpptvyplapgsmvtlgclvkgyfpepvtvtwnsgslasgvhtfpavlqsdlytlsssvt
    vpsstwpsetvtcnvahpasstkvdakivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1sm3L (L:)
    divvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgseksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsradcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sm3L (L:)
    ivvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
    arfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgseksspsvtlf
    ppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassyl
    tltarawerhssyscqvtheghtvekslsr
    

  • Chain 'P':
    No sequence available.