SCOPe 2.08: Domain d1sm3h1: 1sm3 H:2-113

Lineage for d1sm3h1 (1sm3 H:2-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
   Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4

8. Domain d1sm3h1: 1sm3 H:2-113 [20369]
   Other proteins in same PDB: d1sm3h2, d1sm3h3, d1sm3l1, d1sm3l2
   part of tumor-specific Fab SM3 against epithelial mucin Muc1
   complexed with cd, cl

Details for d1sm3h1

PDB Entry: 1sm3, 1.95 Å

PDB Description: crystal structure of the tumor specific antibody sm3 complex with its peptide epitope

PDB Compounds: (H:) sm3 antibody

SCOPe Domain Sequences for d1sm3h1:

Sequence; same for both SEQRES and ATOM records:

>d1sm3h1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
vqlqesggglvqpggsmklscvasgftfsnywmnwvrqspekglewvaeirlksnnyath
yaesvkgrftisrddskssvylqmnnlraedtgiyyctgvgqfaywgqgttvtvss

Timeline for d1sm3h1:

• d1sm3h1 first appeared (with stable ids) in SCOP 1.55
  
• d1sm3h1 appears in SCOPe 2.07