PDB entry 1skt

View 1skt on RCSB PDB site
Description: solution structure of apo n-domain of troponin c, nmr, 40 structures
Deposited on 1998-04-06, released 1998-12-09
The last revision prior to the SCOP 1.63 freeze date was dated 1999-06-21, with a file datestamp of 1999-06-20.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1skt__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1skt_ (-)
    asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
    iieevdedgsgtidfeeflvmmvrqmkeda