PDB entry 1sis

View 1sis on RCSB PDB site
Description: spatial structure of insectotoxin i5a buthus eupeus by 1h nuclear magnetic resonance spectroscopy (russian)
Deposited on 1993-11-11, released 1994-04-30
The last revision prior to the SCOP 1.61 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1sis__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sis_ (-)
    mcmpcfttdpnmakkcrdccggngkcfgpqclcnr