PDB entry 1shk

View 1shk on RCSB PDB site
Description: the three-dimensional structure of shikimate kinase from erwinia chrysanthemi
Class: transferase
Keywords: shikimate kinase, phosphoryl transfer, ADP, shikimate pathway, p-loop protein, transferase
Deposited on 1997-10-27, released 1998-11-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.174
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate kinase
    Species: Erwinia chrysanthemi [TaxId:556]
    Gene: AROL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1shka_
  • Chain 'B':
    Compound: Shikimate kinase
    Species: Erwinia chrysanthemi [TaxId:556]
    Gene: AROL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1shkb_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1shkA (A:)
    mtepifmvgargcgkttvgrelaralgyefvdtdifmqhtsgmtvadvvaaegwpgfrrr
    esealqavatpnrvvatgggmvlleqnrqfmrahgtvvylfapaeelalrlqaspqahqr
    ptltgrpiaeemeavlrerealyqdvahyvvdatqppaaivcelmqtmrlpaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shkA (A:)
    mtepifmvgargcgkttvgrelaralgyefvdtdifmqhtsgmtvadvvaaegwpgfrrr
    esealqavatpnrvvatgggmvlleqnrqfmrahgtvvylfapaeelalrlqiaeemeav
    lrerealyqdvahyvvdatqppaaivcelmqtmrlpaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1shkB (B:)
    mtepifmvgargcgkttvgrelaralgyefvdtdifmqhtsgmtvadvvaaegwpgfrrr
    esealqavatpnrvvatgggmvlleqnrqfmrahgtvvylfapaeelalrlqaspqahqr
    ptltgrpiaeemeavlrerealyqdvahyvvdatqppaaivcelmqtmrlpaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1shkB (B:)
    mtepifmvgargcgkttvgrelaralgyefvdtdifmqhtsgmtvadvvaaegwpgfrrr
    esealqavatpnrvvatgggmvlleqnrqfmrahgtvvylfapaeelalrlqrpiaeeme
    avlrerealyqdvahyvvdatqppaaivcelmqtmrlpa