Lineage for d1shkb_ (1shk B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866357Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins)
    similar to the nucleotide/nucleoside kinases but acts on different substrate
    automatically mapped to Pfam PF01202
  6. 2866358Protein Shikimate kinase (AroK) [52567] (4 species)
  7. 2866362Species Erwinia chrysanthemi [TaxId:556] [52568] (3 PDB entries)
  8. 2866366Domain d1shkb_: 1shk B: [31933]
    complexed with mg

Details for d1shkb_

PDB Entry: 1shk (more details), 1.9 Å

PDB Description: the three-dimensional structure of shikimate kinase from erwinia chrysanthemi
PDB Compounds: (B:) Shikimate kinase

SCOPe Domain Sequences for d1shkb_:

Sequence, based on SEQRES records: (download)

>d1shkb_ c.37.1.2 (B:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}
mtepifmvgargcgkttvgrelaralgyefvdtdifmqhtsgmtvadvvaaegwpgfrrr
esealqavatpnrvvatgggmvlleqnrqfmrahgtvvylfapaeelalrlqaspqahqr
ptltgrpiaeemeavlrerealyqdvahyvvdatqppaaivcelmqtmrlpa

Sequence, based on observed residues (ATOM records): (download)

>d1shkb_ c.37.1.2 (B:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}
mtepifmvgargcgkttvgrelaralgyefvdtdifmqhtsgmtvadvvaaegwpgfrrr
esealqavatpnrvvatgggmvlleqnrqfmrahgtvvylfapaeelalrlqrpiaeeme
avlrerealyqdvahyvvdatqppaaivcelmqtmrlpa

SCOPe Domain Coordinates for d1shkb_:

Click to download the PDB-style file with coordinates for d1shkb_.
(The format of our PDB-style files is described here.)

Timeline for d1shkb_: