PDB entry 1sg7

View 1sg7 on RCSB PDB site
Description: NMR solution structure of the putative cation transport regulator ChaB
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, UNKNOWN FUNCTION
Deposited on 2004-02-23, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative Cation transport regulator chaB
  Species: Escherichia coli [TaxId:562]
  Gene: CHAB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39162 (21-95)
  Domains in SCOPe 2.07: d1sg7a1

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1sg7A (A:)
  mgsshhhhhhhhssgfnprgspyktksdlpesvkhvlpshaqdiykeafnsawdqykdke
  drrddasreetahkvawaavkheyakgdddkwhkks
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1sg7A (A:)
  pyktksdlpesvkhvlpshaqdiykeafnsawdqykdkedrrddasreetahkvawaavk
  heyakgdddkwhkks