PDB entry 1scy

View 1scy on RCSB PDB site
Description: determination of the three-dimensional structure of scyllatoxin by 1h nuclear magnetic resonance
Deposited on 1994-06-02, released 1995-01-26
The last revision prior to the SCOP 1.59 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1scy__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1scy_ (-)
    afcnlrmcqlscrslgllgkcigdkcecvkh