PDB entry 1sbz

View 1sbz on RCSB PDB site
Description: Crystal Structure of dodecameric FMN-dependent Ubix-like Decarboxylase from Escherichia coli O157:H7
Class: lyase
Keywords: FMN binding, Pad1, UbiX, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Structural Genomics, lyase
Deposited on 2004-02-11, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable aromatic acid decarboxylase
    Species: Escherichia coli [TaxId:83334]
    Gene: PAD1, Z4047, ECS3593
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69774 (0-End)
      • modified residue (0)
      • modified residue (6)
      • modified residue (25)
      • modified residue (34)
      • modified residue (80)
      • modified residue (87)
      • modified residue (123)
      • modified residue (133)
      • modified residue (139)
      • modified residue (143)
      • modified residue (147)
    Domains in SCOPe 2.07: d1sbza_
  • Chain 'B':
    Compound: Probable aromatic acid decarboxylase
    Species: Escherichia coli [TaxId:83334]
    Gene: PAD1, Z4047, ECS3593
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69774 (0-End)
      • modified residue (0)
      • modified residue (6)
      • modified residue (25)
      • modified residue (34)
      • modified residue (80)
      • modified residue (87)
      • modified residue (123)
      • modified residue (133)
      • modified residue (139)
      • modified residue (143)
      • modified residue (147)
    Domains in SCOPe 2.07: d1sbzb_
  • Chain 'C':
    Compound: Probable aromatic acid decarboxylase
    Species: Escherichia coli [TaxId:83334]
    Gene: PAD1, Z4047, ECS3593
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69774 (0-End)
      • modified residue (0)
      • modified residue (6)
      • modified residue (25)
      • modified residue (34)
      • modified residue (80)
      • modified residue (87)
      • modified residue (123)
      • modified residue (133)
      • modified residue (139)
      • modified residue (143)
      • modified residue (147)
    Domains in SCOPe 2.07: d1sbzc_
  • Chain 'D':
    Compound: Probable aromatic acid decarboxylase
    Species: Escherichia coli [TaxId:83334]
    Gene: PAD1, Z4047, ECS3593
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69774 (0-End)
      • modified residue (0)
      • modified residue (6)
      • modified residue (25)
      • modified residue (34)
      • modified residue (80)
      • modified residue (87)
      • modified residue (123)
      • modified residue (133)
      • modified residue (139)
      • modified residue (143)
      • modified residue (147)
    Domains in SCOPe 2.07: d1sbzd_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sbzA (A:)
    mklivgmtgatgaplgvallqalrempnvethlvmskwakttieletpysardvaaladf
    shnpadqaatissgsfrtdgmivipcsmktlagiragyadglvgraadvvlkegrklvlv
    premplstihlenmlalsrmgvamvppmpafynhpetvddivhhvvarvldqfglehpya
    rrwqglpqarnfsqene
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sbzA (A:)
    mklivgmtgatgaplgvallqalrempnvethlvmskwakttieletpysardvaaladf
    shnpadqaatissgsfrtdgmivipcsmktlagiragyadglvgraadvvlkegrklvlv
    premplstihlenmlalsrmgvamvppmpafynhpetvddivhhvvarvldqfglehprw
    qgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sbzB (B:)
    mklivgmtgatgaplgvallqalrempnvethlvmskwakttieletpysardvaaladf
    shnpadqaatissgsfrtdgmivipcsmktlagiragyadglvgraadvvlkegrklvlv
    premplstihlenmlalsrmgvamvppmpafynhpetvddivhhvvarvldqfglehpya
    rrwqglpqarnfsqene
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sbzB (B:)
    mklivgmtgatgaplgvallqalrempnvethlvmskwakttieletpysardvaaladf
    shnpadqaatissgsfrtdgmivipcsmktlagiragyadglvgraadvvlkegrklvlv
    premplstihlenmlalsrmgvamvppmpafynhpetvddivhhvvarvldqfgle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sbzC (C:)
    mklivgmtgatgaplgvallqalrempnvethlvmskwakttieletpysardvaaladf
    shnpadqaatissgsfrtdgmivipcsmktlagiragyadglvgraadvvlkegrklvlv
    premplstihlenmlalsrmgvamvppmpafynhpetvddivhhvvarvldqfglehpya
    rrwqglpqarnfsqene
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sbzC (C:)
    mklivgmtgatgaplgvallqalrempnvethlvmskwakttieletpysardvaaladf
    shnpadqaatissgsfrtdgmivipcsmktlagiragyadglvgraadvvlkegrklvlv
    premplstihlenmlalsrmgvamvppmpafynhpetvddivhhvvarvldqfgle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sbzD (D:)
    mklivgmtgatgaplgvallqalrempnvethlvmskwakttieletpysardvaaladf
    shnpadqaatissgsfrtdgmivipcsmktlagiragyadglvgraadvvlkegrklvlv
    premplstihlenmlalsrmgvamvppmpafynhpetvddivhhvvarvldqfglehpya
    rrwqglpqarnfsqene
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sbzD (D:)
    mklivgmtgatgaplgvallqalrempnvethlvmskwakttieletpysardvaaladf
    shnpadqaatissgsfrtdgmivipcsmktlagiragyadglvgraadvvlkegrklvlv
    premplstihlenmlalsrmgvamvppmpafynhpetvddivhhvvarvldqfglehpya
    rrwqg