Lineage for d1sbza_ (1sbz A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108181Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2108182Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families) (S)
  5. 2108183Family c.34.1.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52508] (4 protein domains)
    Pfam PF02441; formerly DFP, DNA/pantothenate metabolism flavoprotein family
  6. 2108215Protein Probable aromatic acid decarboxylase Pad1 [117500] (1 species)
  7. 2108216Species Escherichia coli O157:H7 [TaxId:83334] [117501] (1 PDB entry)
    Uniprot Q9X728
  8. 2108217Domain d1sbza_: 1sbz A: [112068]
    complexed with fmn

Details for d1sbza_

PDB Entry: 1sbz (more details), 2 Å

PDB Description: Crystal Structure of dodecameric FMN-dependent Ubix-like Decarboxylase from Escherichia coli O157:H7
PDB Compounds: (A:) Probable aromatic acid decarboxylase

SCOPe Domain Sequences for d1sbza_:

Sequence, based on SEQRES records: (download)

>d1sbza_ c.34.1.1 (A:) Probable aromatic acid decarboxylase Pad1 {Escherichia coli O157:H7 [TaxId: 83334]}
mklivgmtgatgaplgvallqalrempnvethlvmskwakttieletpysardvaaladf
shnpadqaatissgsfrtdgmivipcsmktlagiragyadglvgraadvvlkegrklvlv
premplstihlenmlalsrmgvamvppmpafynhpetvddivhhvvarvldqfglehpya
rrwqgl

Sequence, based on observed residues (ATOM records): (download)

>d1sbza_ c.34.1.1 (A:) Probable aromatic acid decarboxylase Pad1 {Escherichia coli O157:H7 [TaxId: 83334]}
mklivgmtgatgaplgvallqalrempnvethlvmskwakttieletpysardvaaladf
shnpadqaatissgsfrtdgmivipcsmktlagiragyadglvgraadvvlkegrklvlv
premplstihlenmlalsrmgvamvppmpafynhpetvddivhhvvarvldqfglehprw
qgl

SCOPe Domain Coordinates for d1sbza_:

Click to download the PDB-style file with coordinates for d1sbza_.
(The format of our PDB-style files is described here.)

Timeline for d1sbza_: