PDB entry 1sal
View 1sal on RCSB PDB site
Description: high resolution solution nmr structure of the oligomerization domain of p53 by multi-dimensional nmr (sad structures)
Class: anti-oncogene
Keywords: anti-oncogene
Deposited on
1995-03-12, released
1995-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: tumor suppressor p53
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1sala_ - Chain 'B':
Compound: tumor suppressor p53
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1salb_ - Chain 'C':
Compound: tumor suppressor p53
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1salc_ - Chain 'D':
Compound: tumor suppressor p53
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1sald_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1salA (A:)
kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1salB (B:)
kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1salC (C:)
kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1salD (D:)
kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg