PDB entry 1s7e

View 1s7e on RCSB PDB site
Description: Solution structure of HNF-6
Class: transcription
Keywords: Transcription regulation, Homeobox, DNA-binding, Nuclear protein
Deposited on 2004-01-29, released 2004-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte nuclear factor 6
    Species: Mus musculus [TaxId:10090]
    Gene: rpoD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s7ea1, d1s7ea2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1s7eA (A:)
eintkevaqrittelkrysipqaifaqrvlcrsqgtlsdllrnpkpwsklksgretfrrm
wkwlqepefqrmsalrlaackrkeqehgkdrgntpkkprlvftdvqrrtlhaifkenkrp
skelqitisqqlglelstvsnffmnar