Lineage for d1s7ea1 (1s7e A:103-152)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2304502Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2304503Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2304558Protein Hepatocyte nuclear factor 6 [116780] (1 species)
  7. 2304559Species Mouse (Mus musculus) [TaxId:10090] [116781] (1 PDB entry)
    Uniprot O08755 291-437
  8. 2304560Domain d1s7ea1: 1s7e A:103-152 [112044]
    Other proteins in same PDB: d1s7ea2

Details for d1s7ea1

PDB Entry: 1s7e (more details)

PDB Description: Solution structure of HNF-6
PDB Compounds: (A:) Hepatocyte nuclear factor 6

SCOPe Domain Sequences for d1s7ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]}
prlvftdvqrrtlhaifkenkrpskelqitisqqlglelstvsnffmnar

SCOPe Domain Coordinates for d1s7ea1:

Click to download the PDB-style file with coordinates for d1s7ea1.
(The format of our PDB-style files is described here.)

Timeline for d1s7ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s7ea2