PDB entry 1s5f

View 1s5f on RCSB PDB site
Description: Cholera holotoxin, Crystal form 2
Class: transferase,toxin
Keywords: cholera toxin, heat-labile enterotoxin, ADP ribose transferases, AB5 toxins, TRANSFERASE,TOXIN
Deposited on 2004-01-20, released 2004-04-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.216
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cholera enterotoxin, A chain
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXA, TOXA, VC1457
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1s5fa_
  • Chain 'D':
    Compound: cholera toxin B protein (CTB)
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB, TOXB, VC1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1s5fd_
  • Chain 'E':
    Compound: cholera toxin B protein (CTB)
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB, TOXB, VC1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1s5fe_
  • Chain 'F':
    Compound: cholera toxin B protein (CTB)
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB, TOXB, VC1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1s5ff_
  • Chain 'G':
    Compound: cholera toxin B protein (CTB)
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB, TOXB, VC1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1s5fg_
  • Chain 'H':
    Compound: cholera toxin B protein (CTB)
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB, TOXB, VC1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1s5fh_
  • Heterogens: GAL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s5fA (A:)
    nddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgyv
    stsislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpdeqevsalggip
    ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
    hhappgcgnaprssmsntcdektqslgvkfldeyqskvkrqifsgyqsdidthnrikdel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5fA (A:)
    nddklyradsrppdeikqsgglmprgqseyfdqmninlydhargtqtgfvrhddgyvsts
    islrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpdeqevsalggipysq
    iygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwihha
    ppgcgntcdektqslgvkfldeyqskvkrqifsgyqsdidthnr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5fD (D:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5fE (E:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5fF (F:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1s5fG (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5fG (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisma
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5fH (H:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman