PDB entry 1s5e

View 1s5e on RCSB PDB site
Description: Cholera holotoxin, Crystal form 1
Deposited on 2004-01-20, released 2004-04-06
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.169
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1s5ea_
  • Chain 'B':
    Domains in SCOP 1.67: d1s5eb_
  • Chain 'D':
    Domains in SCOP 1.67: d1s5ed_
  • Chain 'E':
    Domains in SCOP 1.67: d1s5ee_
  • Chain 'F':
    Domains in SCOP 1.67: d1s5ef_
  • Chain 'G':
    Domains in SCOP 1.67: d1s5eg_
  • Chain 'H':
    Domains in SCOP 1.67: d1s5eh_
  • Chain 'J':
    Domains in SCOP 1.67: d1s5ej_
  • Chain 'K':
    Domains in SCOP 1.67: d1s5ek_
  • Chain 'L':
    Domains in SCOP 1.67: d1s5el_
  • Chain 'M':
    Domains in SCOP 1.67: d1s5em_
  • Chain 'N':
    Domains in SCOP 1.67: d1s5en_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s5eA (A:)
    nddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgyv
    stsislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpdeqevsalggip
    ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
    hhappgcgnaprssmsntcdektqslgvkfldeyqskvkrqifsgyqsdidthnrikdel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5eA (A:)
    nddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqgfvrhddgyvs
    tsislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpdeqevsalggipy
    sqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwih
    happgcgnaprsntcdektqslgvkfldeyqskvkrqifsgyqsdidthnri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s5eB (B:)
    nddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgyv
    stsislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpdeqevsalggip
    ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
    hhappgcgnaprssmsntcdektqslgvkfldeyqskvkrqifsgyqsdidthnrikdel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5eB (B:)
    nddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgyv
    stsislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpdeqevsalggip
    ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
    hhappgcgntcdektqslgvkfldeyqskvkrqifsgyqsdidthnr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5eD (D:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5eE (E:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5eF (F:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1s5eG (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5eG (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisma
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5eH (H:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5eJ (J:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5eK (K:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5eL (L:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5eM (M:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5eN (N:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman