Lineage for d1s5ed_ (1s5e D:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 373966Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 373967Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 373968Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 373969Species Vibrio cholerae [TaxId:666] [50209] (19 PDB entries)
  8. 374005Domain d1s5ed_: 1s5e D: [98549]
    Other proteins in same PDB: d1s5ea_, d1s5eb_

Details for d1s5ed_

PDB Entry: 1s5e (more details), 1.9 Å

PDB Description: cholera holotoxin, crystal form 1

SCOP Domain Sequences for d1s5ed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5ed_ b.40.2.1 (D:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOP Domain Coordinates for d1s5ed_:

Click to download the PDB-style file with coordinates for d1s5ed_.
(The format of our PDB-style files is described here.)

Timeline for d1s5ed_: