PDB entry 1s5d
View 1s5d on RCSB PDB site
Description: Cholera holotoxin with an A-subunit Y30S mutation, Crystal form 2
Class: transferase,toxin
Keywords: cholera toxin, heat-labile enterotoxin, ADP ribose transferases, AB5 toxins, TRANSFERASE,TOXIN
Deposited on
2004-01-20, released
2004-04-06
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.163
AEROSPACI score: 0.56
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cholera enterotoxin, A chain
Species: Vibrio cholerae [TaxId:666]
Gene: CTXA, TOXA, VC1457
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1s5da_ - Chain 'D':
Compound: cholera toxin B protein (CTB)
Species: Vibrio cholerae [TaxId:666]
Gene: CTXB, TOXB, VC1456
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1s5dd_ - Chain 'E':
Compound: cholera toxin B protein (CTB)
Species: Vibrio cholerae [TaxId:666]
Gene: CTXB, TOXB, VC1456
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1s5de_ - Chain 'F':
Compound: cholera toxin B protein (CTB)
Species: Vibrio cholerae [TaxId:666]
Gene: CTXB, TOXB, VC1456
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1s5df_ - Chain 'G':
Compound: cholera toxin B protein (CTB)
Species: Vibrio cholerae [TaxId:666]
Gene: CTXB, TOXB, VC1456
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1s5dg_ - Chain 'H':
Compound: cholera toxin B protein (CTB)
Species: Vibrio cholerae [TaxId:666]
Gene: CTXB, TOXB, VC1456
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1s5dh_ - Heterogens: GAL, NA, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1s5dA (A:)
nddklyradsrppdeikqsgglmprgqsesfdrgtqmninlydhargtqtgfvrhddgyv
stsislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpdeqevsalggip
ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
hhappgcgnaprssmsntcdektqslgvkfldeyqskvkrqifsgyqsdidthnrikdel
Sequence, based on observed residues (ATOM records): (download)
>1s5dA (A:)
nddklyradsrppdeikqsgglmprgqsqmninlydhargttgfvrhddgyvstsislrs
ahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpdeqevsalggipysqiygwy
rvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwihhappgcg
tcdektqslgvkfldeyqskvkrqifsgyqsdidthnr
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1s5dD (D:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>1s5dE (E:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'F':
Sequence; same for both SEQRES and ATOM records: (download)
>1s5dF (F:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'G':
Sequence; same for both SEQRES and ATOM records: (download)
>1s5dG (G:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>1s5dH (H:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman