PDB entry 1s5c

View 1s5c on RCSB PDB site
Description: Cholera holotoxin with an A-subunit Y30S mutation, Crystal form 1
Deposited on 2004-01-20, released 2004-04-06
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.199
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1s5ca_
  • Chain 'D':
    Domains in SCOP 1.67: d1s5cd_
  • Chain 'E':
    Domains in SCOP 1.67: d1s5ce_
  • Chain 'F':
    Domains in SCOP 1.67: d1s5cf_
  • Chain 'G':
    Domains in SCOP 1.67: d1s5cg_
  • Chain 'H':
    Domains in SCOP 1.67: d1s5ch_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s5cA (A:)
    nddklyradsrppdeikqsgglmprgqsesfdrgtqmninlydhargtqtgfvrhddgyv
    stsislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpdeqevsalggip
    ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
    hhappgcgnaprssmsntcdektqslgvkfldeyqskvkrqifsgyqsdidthnrikdel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5cA (A:)
    nddklyradsrppdeikqsgglmprmninlydhargtqgfvrhddgyvstsislrsahlv
    gqtilsghstyyiyviatapnmfnvndvlgaysphpdeqevsalggipysqiygwyrvhf
    gvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwihhappgcgnsnt
    cdektqslgvkfldeyqskvkrqifsgyqsdidthn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5cD (D:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5cE (E:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5cF (F:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5cG (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5cH (H:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman