Lineage for d1s5ca_ (1s5c A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 421044Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 421045Superfamily d.166.1: ADP-ribosylation [56399] (3 families) (S)
  5. 421046Family d.166.1.1: ADP-ribosylating toxins [56400] (9 proteins)
  6. 421062Protein Cholera toxin [56410] (1 species)
  7. 421063Species Vibrio cholerae [TaxId:666] [56411] (6 PDB entries)
  8. 421068Domain d1s5ca_: 1s5c A: [98535]
    Other proteins in same PDB: d1s5cd_, d1s5ce_, d1s5cf_, d1s5cg_, d1s5ch_
    complexed with na; mutant

Details for d1s5ca_

PDB Entry: 1s5c (more details), 2.5 Å

PDB Description: Cholera holotoxin with an A-subunit Y30S mutation, Crystal form 1

SCOP Domain Sequences for d1s5ca_:

Sequence, based on SEQRES records: (download)

>d1s5ca_ d.166.1.1 (A:) Cholera toxin {Vibrio cholerae}
nddklyradsrppdeikqsgglmprgqsesfdrgtqmninlydhargtqtgfvrhddgyv
stsislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpdeqevsalggip
ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
hhappgcgnaprssmsntcdektqslgvkfldeyqskvkrqifsgyqsdidthn

Sequence, based on observed residues (ATOM records): (download)

>d1s5ca_ d.166.1.1 (A:) Cholera toxin {Vibrio cholerae}
nddklyradsrppdeikqsgglmprmninlydhargtqgfvrhddgyvstsislrsahlv
gqtilsghstyyiyviatapnmfnvndvlgaysphpdeqevsalggipysqiygwyrvhf
gvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwihhappgcgnsnt
cdektqslgvkfldeyqskvkrqifsgyqsdidthn

SCOP Domain Coordinates for d1s5ca_:

Click to download the PDB-style file with coordinates for d1s5ca_.
(The format of our PDB-style files is described here.)

Timeline for d1s5ca_: