PDB entry 1s4r

View 1s4r on RCSB PDB site
Description: Structure of a reaction intermediate in the photocycle of PYP extracted by a SVD-driven analysis
Class: photosynthesis
Keywords: reaction intermediate
Deposited on 2004-01-17, released 2004-04-13
The last revision prior to the SCOP 1.75 freeze date was dated 2004-04-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.242
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Photoactive yellow protein
  Species: Ectothiorhodospira halophila
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16113 (0-124)
  Domains in SCOP 1.75: d1s4ra_
• Heterogens: HC4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1s4rA (A:)
  mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
  nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
  fvkrv