Lineage for d1s4ra_ (1s4r A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870642Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 870769Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (7 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 870770Family d.110.3.1: PYP-like [55786] (2 proteins)
  6. 870771Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 870772Species Ectothiorhodospira halophila [TaxId:17] [55788] (43 PDB entries)
    Uniprot P16113
  8. 870807Domain d1s4ra_: 1s4r A: [98508]
    complexed with hc4

Details for d1s4ra_

PDB Entry: 1s4r (more details), 1.9 Å

PDB Description: structure of a reaction intermediate in the photocycle of pyp extracted by a svd-driven analysis
PDB Compounds: (A:) Photoactive yellow protein

SCOP Domain Sequences for d1s4ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s4ra_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

SCOP Domain Coordinates for d1s4ra_:

Click to download the PDB-style file with coordinates for d1s4ra_.
(The format of our PDB-style files is described here.)

Timeline for d1s4ra_: