PDB entry 1s3t

View 1s3t on RCSB PDB site
Description: borate inhibited bacillus pasteurii urease crystal structure
Class: hydrolase
Keywords: UREASE, BACILLUS PASTEURII, NICKEL, METALLOENZYME, borate, HYDROLASE
Deposited on 2004-01-14, released 2004-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-08, with a file datestamp of 2015-07-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urease gamma subunit
    Species: SPOROSARCINA PASTEURII [TaxId:1474]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41022 (0-99)
      • modified residue (0)
    Domains in SCOPe 2.07: d1s3ta_
  • Chain 'B':
    Compound: urease beta subunit
    Species: SPOROSARCINA PASTEURII [TaxId:1474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s3tb_
  • Chain 'C':
    Compound: urease alpha subunit
    Species: SPOROSARCINA PASTEURII [TaxId:1474]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41020 (0-569)
      • conflict (18)
      • conflict (27)
      • insertion (28)
      • conflict (35-37)
      • modified residue (219)
      • conflict (262)
      • conflict (419)
    Domains in SCOPe 2.07: d1s3tc1, d1s3tc2
  • Heterogens: NI, SO4, BO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s3tA (A:)
    mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
    khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s3tB (B:)
    msnnnyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdra
    egigrrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakel
    gykgve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3tB (B:)
    nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
    rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
    ve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s3tC (C:)
    mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
    trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
    viaaegkivtaggidthvhfinpdqvdvalangittlfgggtgpaegskattvtpgpwni
    ekmlksteglpinvgilgkghgssiapimeqidagaaglkihedwgatpasidrsltvad
    eadvqvaihsdtlneagfledtlraingrvihsfhvegaggghapdimamaghpnvlpss
    tnptrpftvntidehldmlmvchhlkqnipedvafadsrirpetiaaedilhdlgiismm
    stdalamgragemvlrtwqtadkmkkqrgplaeekngsdnfrlkryvskytinpaiaqgi
    ahevgsieegkfadlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmy
    gtvgdlihdtnitfmskssiqqgvpaklglkrrigtvkncrnigkkdmkwndvttdidin
    petyevkvdgevltcepvkelpmaqryflf