Class b: All beta proteins [48724] (180 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein) |
Protein alpha-Subunit of urease [51340] (4 species) |
Species Bacillus pasteurii [TaxId:1474] [51342] (9 PDB entries) |
Domain d1s3tc1: 1s3t C:1-131,C:435-483 [98462] Other proteins in same PDB: d1s3ta_, d1s3tb_, d1s3tc2 complexed with bo3, ni, so4 |
PDB Entry: 1s3t (more details), 2.1 Å
SCOPe Domain Sequences for d1s3tc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s3tc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii [TaxId: 1474]} mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt v
Timeline for d1s3tc1: