SCOPe 2.08: Domain d1s3tc1: 1s3t C:1-131,C:435-483

Lineage for d1s3tc1 (1s3t C:1-131,C:435-483)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)

6. Protein alpha-Subunit of urease [51340] (4 species)

7. Species Bacillus pasteurii [TaxId:1474] [51342] (9 PDB entries)

8. Domain d1s3tc1: 1s3t C:1-131,C:435-483 [98462]
   Other proteins in same PDB: d1s3ta_, d1s3tb_, d1s3tc2
   complexed with bo3, ni, so4

Details for d1s3tc1

PDB Entry: 1s3t, 2.1 Å

PDB Description: borate inhibited bacillus pasteurii urease crystal structure

PDB Compounds: (C:) urease alpha subunit

SCOPe Domain Sequences for d1s3tc1:

Sequence; same for both SEQRES and ATOM records:

>d1s3tc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii [TaxId: 1474]}
mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt
v

Timeline for d1s3tc1:

• d1s3tc1 first appeared in SCOP 1.67
  
• d1s3tc1 appears in SCOPe 2.07